PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN03899.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 321aa    MW: 36623.5 Da    PI: 9.8673
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN03899.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding475.9e-15189235148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W+  Ed  l+++v+q+G + W++Ia+ +   Rt+kqc++rw+++l
       KHN03899.1 189 KGKWSMKEDRDLIELVNQYGLKKWSKIAKLLH-CRTGKQCQERWNNHL 235
                      79******************************.*************97 PP

2Myb_DNA-binding42.12e-13241283145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT  Ed+++++ + + G++ W+ Ia++++ gR ++ +k+rw+
       KHN03899.1 241 KDSWTLKEDKIFIETHIKVGNK-WSEIAKRLP-GRAPNTIKNRWN 283
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.072184239IPR017930Myb domain
SuperFamilySSF466891.14E-27186282IPR009057Homeodomain-like
SMARTSM007176.4E-13188237IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-24190243IPR009057Homeodomain-like
CDDcd001673.76E-13191235No hitNo description
PfamPF139214.9E-16192250No hitNo description
SMARTSM007171.7E-10240288IPR001005SANT/Myb domain
PROSITE profilePS5129416.616240290IPR017930Myb domain
CDDcd001671.44E-8243283No hitNo description
Gene3DG3DSA:1.10.10.609.8E-18244289IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MEFDPSFQGP QYLSSLFPRN SYLKPLTQTI FPSQSSIFTP PPPSSVMFHP NNNSHHFQDH  60
IMNVPTNNTP FVMEGPSNPI TTPMYGITTP SLGDGSSLGG FVNVQCHPPM MLAPKNNNKM  120
EALYGQDKGK AISDFSQKTM LCLSEDSSSK SPSPVSLPND WWMSQYHWDT DQKVKVEKDS  180
NIGNDNVIKG KWSMKEDRDL IELVNQYGLK KWSKIAKLLH CRTGKQCQER WNNHLQPNIR  240
KDSWTLKEDK IFIETHIKVG NKWSEIAKRL PGRAPNTIKN RWNGSKRRKN DKRQNKNKHG  300
PYDGSVLDAY VKMVTATEET T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-361832911109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006576590.20.0PREDICTED: myb-related protein A-like
TrEMBLA0A0B2P8K80.0A0A0B2P8K8_GLYSO; Transcription factor MYB98
STRINGGLYMA03G15930.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF143361018
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-40myb domain protein 98
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]